Niste prijavljeni

Dragi posjetioče, Dobrodošli na Otvoreni Forum - Novi Pazar. Ukoliko je ovo Vaša prva posjeta molimo vas pročitajte Pomoć. U pomoći je objašnjeno kako ovaj forum radi. Morate biti registrirani kako bi vidjeli sve teme i sve forume. Molimo vas da se registrirate ili da ovdje pročitate kako se registrirati. Ukoliko ste već registrirani molimo ulogirajte se ovdje.

ernad

Zlatna sredina

(10)

  • »ernad« je muško
  • »ernad« je autor ove teme

Postovi: 223

Datum registracije: 01.01.2004

Lokacija: Srbija iCrna Gora, Novi Pazar

  • Poruku poslati

1

Nedjelja, 20. Juni 2004

Najduza rec

Lako i jednostavno:
Koja je najduza rec koju ste culi???
I koliko ta rec (da mi ne bi brojali :O ) ima slova???
Ja mislim da je najduza rec koju sam ja cuo

OTORINOLARINGOLOGIJA = 20 reci

Hocel me ko nadmasit? :D
Pravda, ponekad spava, ali nikad ne umire...

2

Nedjelja, 20. Juni 2004

Citirano

Orginalno od ernad


OTORINOLARINGOLOGIJA = 20 reci



Mislio si 20 slova ;) ?


Evo najduze reci (zvanicno najduza nemacka rec) :
Donaudampfschifffahrtsgesellschaftsraddampferkapitänskajütentürsicherheitsschlüssel

Ako se ne zabrojih ova rec sadrzi negde oko 83 slova.
"Ti sa svakim lijepo! I trazi da se dobra djela cine, a neznalica se kloni!" (El-'Araf, 199)

Chonbey

Zlatna sredina

(10)

  • »Chonbey« je muško

Postovi: 286

Datum registracije: 10.03.2004

Lokacija: US

  • Poruku poslati

3

Nedjelja, 20. Juni 2004

Koliko se secam, svojevremeno je to bila (ne znam da li su se i reci iz specificnih oblasti kao medicina racunale)

PRIJESTOLONASLJEDNICA = 20
Solve it. Solve it quickly, right or wrong. If you solve it wrong, it will come back and slap you in the face, and then you can solve it right

Utopljena u Casi

Zlatna sredina

(10)

  • »Utopljena u Casi« je žensko

Postovi: 242

Datum registracije: 01.05.2004

  • Poruku poslati

4

Ponedjeljak, 21. Juni 2004

Prestolonasljednikovica
Velikodostojanstvenici

i jedna njemachka rijech uz koju moram postati i pojashnjenje :)

Hottentottenstottertrottelmutterlattengitterkotterbeutelratenattentater 72 slova :)

Sigurno se vechina vas nekad u zivotu susrela sa ovim jezikom. Koliko je on zaista logichan i lak za uchenje saznachete iz teksta koji slijedi...

Dakle, njemachki jezik je relativno lahak. Za onog ko zna latinski, i naviknutog na padeze, njemachki jezik ne predstavlja neku teshkochu... To je ono shto profesori njemachkog kazu na prvom casu.... A onda pochinju sa der, die, das, den itd, govorechi da je sve dalje u stvari logichno. Znaci lahko.

To chemo zato na slijedechem primjeru i dokazati. Kao prvo, potrebna nam je dotichna knjiga na njemachkom jeziku. Radi se o prelijepoj knjizi u skupom platnenom povezu, izdatoj u Dortmundu, koja govori o obichajima u plemenu Hotentota (auf Deutsch: Hottentotten).

Knjiga kaze kako kengure (Beutelraten) hvataju i zatvaraju u kaveze (Kotter), koje zatim prekrivaju tkaninom (Lattengitter) da bi ih zashtitili od nevremena. Na njemachkom se ti kavezi zovu: Kavezi prekriveni tkaninom (ili Lattengitterkotter), a kada su u njima i kenguri, to su onda Lattengitterkotterbeutelraten. Jednog dana su Hotentoti uhvatili ubicu (Attentater), optuzenog da je ubio majku (Mutter), takodje iz plemena Hotentota (dakle Hottentottermutter), majku priglupog i mucavog djeteta (Stottertrottel). Ta se majka na njemachkom dakle zove Hottentottenstottertrottelmutter, a njen ubica, naravno, Hottentottenstottertrottelmutterattentater. Privedenog su zatim privremeno zatvorili u kavez za kengure (Beutelratenlattengitterkotter), iz koga je on ubrzo zatim pobjegao. Svi su se odmah dali u potragu za njim, kada je jedan Hotentotski ratnik pobjedonosno uzviknuo:

- Uhvatio sam ubicu (Attentater) !!!

- Shta? Koga? , upita ga poglavica.

- Pa, Lattengitterkotterbeutelratenattentater !!! uzvrati ovaj.

- Kako ? Ubicu iz kaveza za kengure prekrivenog tkaninom ??? upita poglavica.

- Da, to je Hottentottenstottertrottelmutterattentater (Ubica majke priglupog i mucavog djeteta), rece ratnik.

- Pa naravno, rece poglavica, samo trebao si odmah da mi kazes da je to u stvari Hottentottenstottertrottelmutterlattengitterkotterbeutelratenattentater !!!

Vidite, njemachki jezik je izuzetno lahak, samo se treba dovoljno zainteresovati.

preuzeto sa IB

Tu sam…tu sam gdje jesam. Takva kakva jesam. Moje meso. Moja krv. Moj glas. I, tudja presuda – na život. .

Chonbey

Zlatna sredina

(10)

  • »Chonbey« je muško

Postovi: 286

Datum registracije: 10.03.2004

Lokacija: US

  • Poruku poslati

5

Ponedjeljak, 21. Juni 2004

Sta sve moze da se izgugla 8o

Evo sta nadjoh za najduzu rec na engleskom jeziku (1909 slova !), mislim da ce i html malo da pobrljavi od ovoga

me­thionyl­glutaminyl­arginyl­tyrosylglutamylserylleucylphenyl­alanyl­alanyl­glutaminyl­leucyllysylglutamylarginyl­lysylglutamylglycylalanyl­phenyl­alanyl­valylprolylphenyl­alanyl­valylthreonyl­leucylglycylaspartylprolylglycylisoleucylglutamylglutaminyl­serylleucyllysylisoleucylaspartylthreonyl­leucylisoleucylglutamylalanyl­glycylalanyl­aspartylalanyl­leucylglutamylleucylglycylisoleucylprolylphenyl­alanyl­serylaspartylprolylleucylalanyl­aspartylglycylprolylthreonyl­isoleucylglutaminyl­asparaginyl­alanyl­threonyl­leucylarginyl­alanyl­phenyl­alanyl­alanyl­alanyl­glycylvalylthreonyl­prolylalanyl­glutaminyl­cysteinyl­phenyl­alanyl­glutamylme­thionyl­leucylalanyl­leucylisoleucylarginyl­glutaminyl­lysylhistidylprolylthreonyl­isoleucylprolylisoleucylglycylleucylleucylme­thionyl­tyrosylalanyl­asparaginyl­leucylvalylphenyl­alanyl­asparaginyl­lysylglycylisoleucylaspartylglutamylphenyl­alanyl­tyrosylalanyl­glutaminyl­cysteinyl­glutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanyl­aspartylvalylprolylvalylglutaminyl­glutamylserylalanyl­prolylphenyl­alanyl­arginyl­glutaminyl­alanyl­alanyl­leucylarginyl­histidylasparaginyl­valylalanyl­prolylisoleucylphenyl­alanyl­isoleucylcysteinyl­prolylprolylaspartylalanyl­aspartylaspartylaspartylleucylleucylarginyl­glutaminyl­isoleucylalanyl­seryltyrosylglycylarginyl­glycyltyrosylthreonyl­tyrosylleucylleucylserylarginyl­alanyl­glycylvalylthreonyl­glycylalanyl­glutamylasparaginyl­arginyl­alanyl­alanyl­leucylprolylleucylasparaginyl­histidylleucylvalylalanyl­lysylleucyllysylglutamyltyrosylasparaginyl­alanyl­alanyl­prolylprolylleucylglutaminyl­glycylphenyl­alanyl­glycylisoleucylserylalanyl­prolylaspartylglutaminyl­valyllysylalanyl­alanyl­isoleucylaspartylalanyl­glycylalanyl­alanyl­glycylalanyl­isoleucylserylglycylserylalanyl­isoleucylvalyllysylisoleucylisoleucylglutamylglutaminyl­histidylasparaginyl­isoleucylglutamylprolylglutamyllysylme­thionyl­leucylalanyl­alanyl­leucyllysylvalylphenyl­alanyl­valylglutaminyl­prolylme­thionyl­lysylalanyl­alanyl­threonyl­arginyl­serine
Ovo je neki hemijski izraz :D

Link - Najduze reci u engleskom
Solve it. Solve it quickly, right or wrong. If you solve it wrong, it will come back and slap you in the face, and then you can solve it right

hobbes

Profesionalac

(10)

  • »hobbes« je muško

Postovi: 1.679

Datum registracije: 21.08.2002

Lokacija: izbegavam

  • Poruku poslati

6

Ponedjeljak, 21. Juni 2004

cekoslovakyalastirdiklarindanmisiniz ovo je najduza turska rec od 36 slova.
I Turci sklapaju reci slicno Nemcima.

alBazari

Profesionalac

(10)

  • »alBazari« je muško

Postovi: 772

Datum registracije: 09.12.2002

Lokacija: Novi Pazar, Sandžak

  • Poruku poslati

7

Ponedjeljak, 21. Juni 2004

Najduza rijec na svijet je engleska i glasi:

SMILES


Izmedju prvog i posljednjeg slova S nalazi se rastojanje od citave jedne milje. :]


"Ko se odvaži i radi brzo biće izbavljen,
dok i tragalac koji je spor može gajiti samo nadu." (Hz. Alija)

PASHA

Zlatna sredina

(5)

  • »PASHA« je zabranjen

Postovi: 182

Datum registracije: 29.01.2004

Lokacija: Novi Pazar

  • Poruku poslati

8

Ponedjeljak, 21. Juni 2004

Selam Alejkum Dobri Ljudi...

Ima i duzih u rijecniku nasih jezika a to je ona stara komunisticka sklepalica...

SVENARODNOOSLOBODILACKA (BORBA) = 23 SLOVA

Selam Alejkum...

ed

Veteran

(61)

  • »ed« je muško

Postovi: 3.336

Datum registracije: 17.12.2002

Lokacija: D

  • Poruku poslati

9

Ponedjeljak, 21. Juni 2004

Citirano

Orginalno od Utopljena u Casi
Prestolonasljednikovica

Ima jedna malo duza: Prijestolonasljednikovica - za dva slova duza od tvoje :)

Citirano

Orginalno od pink
Ako se ne zabrojih ova rec sadrzi negde oko 83 slova.

Vidi sliku.
Čvrsto je ubijeđen u svoje stavove. Nemojte ga zbunjivati činjenicama!

10

Ponedjeljak, 21. Juni 2004

@ ed : Rec ima 83 slova i napisana je bez Leerzeichen. Ne znam sta je skripti te je moju rec onako prepolovila ;(

P.S.To neka admin proveri skriptu, kad se vrati sa odmora.
"Ti sa svakim lijepo! I trazi da se dobra djela cine, a neznalica se kloni!" (El-'Araf, 199)

ed

Veteran

(61)

  • »ed« je muško

Postovi: 3.336

Datum registracije: 17.12.2002

Lokacija: D

  • Poruku poslati

11

Ponedjeljak, 21. Juni 2004

Htio sam reci da koristis opciju Word-a i da se ne zamaras brojeci slova. Ja sam u medjuvremenu kod mene izbrisao Leerzeichen. Vjerovatno to i ti mozes uraditi ispravljajuci svoj post.
Čvrsto je ubijeđen u svoje stavove. Nemojte ga zbunjivati činjenicama!

12

Ponedjeljak, 21. Juni 2004

Hvala za opciju brojanja , koristila ja ;), a sto se ispravljanja posta tice ja nemam sta da ispravljam jer sam sasvim ispravno napisala rec, dakle nije do mene. ( Moze se lako proveriti ukoliko se pokusa citirati post koji sadrzi pomenutu rec).
"Ti sa svakim lijepo! I trazi da se dobra djela cine, a neznalica se kloni!" (El-'Araf, 199)

13

Ponedjeljak, 21. Juni 2004

Ne znam koja bi bila najduza rijec (a vi ih vec i ispisaste dovoljno) al meni nije jasno sto je 'skracenica' tako duga rijec. Istina da sam na ovo sto izgovorih naisao negde kao foru (stos) ali stvarno mi nije jasno jer ni malo ne predstavlja (oslikava) ono cemu sluze iste (skracenice). Cak je i na engleskom isti slucaj (a cak je i duza rijec), skracenica se kaze abbreviation. Sto bi rekla pinki u ovakvim slucajevima ?( .. ili pak :rolleyes:
mogu ja da se potpisem i bolje...

Tulumba4All

Profesionalac

(10)

  • »Tulumba4All« je muško

Postovi: 700

Datum registracije: 04.09.2002

Lokacija: UK

  • Poruku poslati

14

Ponedjeljak, 21. Juni 2004

Citirano

Orginalno od fingersbroken
Cak je i na engleskom isti slucaj (a cak je i duza rijec), skracenica se kaze abbreviation. Sto bi rekla pinki u ovakvim slucajevima ?( .. ili pak :rolleyes:


Ali uvek mozes da napravis skracenicu od skrecenice 8) . Moja omiljena je TLA (three letter abbreviation).
... And Tulumba for all
[SIZE=1]If you can't convince them, confuse them.

A fanatic is one who can't change his mind and won't change the subject

[/SIZE]

Dinna_

Zlatna sredina

(10)

  • »Dinna_« je žensko

Postovi: 460

Datum registracije: 01.04.2003

Lokacija: vrtim se tudekanke

  • Poruku poslati

15

Ponedjeljak, 21. Juni 2004

Uh gotovo polomi jezik :D

sedamdesetcetvorogodisnjakinja
[SIZE=2] Veseo čovjek je kao sunce; kud god ide osvjetljava[/SIZE]


HaNuMa_78

Profesionalac

(10)

Postovi: 1.293

Datum registracije: 01.09.2002

Lokacija: Grand Rapids

  • Poruku poslati

16

Utorak, 22. Juni 2004

Nadjoh ovde rijec, koja ima 18645 slova. Za smisao te rijeci ne garantujem.
EŠ-HEDU EN LĀ ILĀHE ILLELLĀH, VE EŠ-HEDU ENNE MUHAMMEDEN ABDUHŪ VE RESŪLUHŪ

  • »And_U_Price« je muško

Postovi: 1.890

Datum registracije: 28.07.2002

Lokacija: Novi Pazar

  • Poruku poslati

17

Utorak, 22. Juni 2004

Citirano

Orginalno od Chonbey
me­thionyl­glutaminyl­arginyl­tyrosylglutamylserylleucylphenyl­alanyl­alanyl­glutaminyl­leucyllysylglutamylarginyl­lysylglutamylglycylalanyl­phenyl­alanyl­valylprolylphenyl­alanyl­valylthreonyl­leucylglycylaspartylprolylglycylisoleucylglutamylglutaminyl­serylleucyllysylisoleucylaspartylthreonyl­leucylisoleucylglutamylalanyl­glycylalanyl­aspartylalanyl­leucylglutamylleucylglycylisoleucylprolylphenyl­alanyl­serylaspartylprolylleucylalanyl­aspartylglycylprolylthreonyl­isoleucylglutaminyl­asparaginyl­alanyl­threonyl­leucylarginyl­alanyl­phenyl­alanyl­alanyl­alanyl­glycylvalylthreonyl­prolylalanyl­glutaminyl­cysteinyl­phenyl­alanyl­glutamylme­thionyl­leucylalanyl­leucylisoleucylarginyl­glutaminyl­lysylhistidylprolylthreonyl­isoleucylprolylisoleucylglycylleucylleucylme­thionyl­tyrosylalanyl­asparaginyl­leucylvalylphenyl­alanyl­asparaginyl­lysylglycylisoleucylaspartylglutamylphenyl­alanyl­tyrosylalanyl­glutaminyl­cysteinyl­glutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanyl­aspartylvalylprolylvalylglutaminyl­glutamylserylalanyl­prolylphenyl­alanyl­arginyl­glutaminyl­alanyl­alanyl­leucylarginyl­histidylasparaginyl­valylalanyl­prolylisoleucylphenyl­alanyl­isoleucylcysteinyl­prolylprolylaspartylalanyl­aspartylaspartylaspartylleucylleucylarginyl­glutaminyl­isoleucylalanyl­seryltyrosylglycylarginyl­glycyltyrosylthreonyl­tyrosylleucylleucylserylarginyl­alanyl­glycylvalylthreonyl­glycylalanyl­glutamylasparaginyl­arginyl­alanyl­alanyl­leucylprolylleucylasparaginyl­histidylleucylvalylalanyl­lysylleucyllysylglutamyltyrosylasparaginyl­alanyl­alanyl­prolylprolylleucylglutaminyl­glycylphenyl­alanyl­glycylisoleucylserylalanyl­prolylaspartylglutaminyl­valyllysylalanyl­alanyl­isoleucylaspartylalanyl­glycylalanyl­alanyl­glycylalanyl­isoleucylserylglycylserylalanyl­isoleucylvalyllysylisoleucylisoleucylglutamylglutaminyl­histidylasparaginyl­isoleucylglutamylprolylglutamyllysylme­thionyl­leucylalanyl­alanyl­leucyllysylvalylphenyl­alanyl­valylglutaminyl­prolylme­thionyl­lysylalanyl­alanyl­threonyl­arginyl­serine


Ovde je u pitanju neki protein ciji je naziv izveden na osnovu pobrajanja svih aminokiselina koje se nalaze u njegovom sastavu. U praksi se ovo nikada ne desava, vec takva jedinjenja imaju tzv. trivijalna imena. Primer je recimo insulin , sto je trivijalno ime za polipeptid (protein) koji se sastoji od 143 aminokiseline. Ovo sto si ti nasao i ne moze biti jedna rijec jer se popraviu izmedju naziva aminokiselina stavlja crtica tako da to biva slozenica! U svakom slucaju pokusaj koji kod mene izaziva simpatije :)
Sit Hungry Doesn't Believe

CHAMPION

Početnik

(10)

  • »CHAMPION« je žensko
  • »CHAMPION« je zabranjen

Postovi: 32

Datum registracije: 22.06.2004

Lokacija: Novi Pazar-Beograd

  • Poruku poslati

18

Utorak, 22. Juni 2004

NAJDUZA......

SIGURNO SAM CULA PUNO DUGACKIH RECI NA STRANIM JEZICIMA, ALI IH CESTO NISAM NI PRIMETILA JER JE NE MOGUCE MADA GOVORIM PERFEKTNO JEDAN OD EVROPSKIH JEZIKA (FRANCUSKI), A DOSTA DOBRO ITALIJANSKI I NEMACKI. MENI JE JAKO BITNO NACI NAJDUZU REC NA JEZIKU KOJI MI NA OVIM PROSTORIMA MOZEMO SVI RAZUMETI I NARAVNO DA TO BUDE KNJIZEVNA REC. JA SAM SE ZA SADA SETILA RECI:

VISOKOPREOSVESTENSTVENI (23 SLOVA).

DA LI SAM U PRAVU?

CHAMPION

19

Utorak, 22. Juni 2004

Citirano

Orginalno od CHAMPION


VISOKOPREOSVESTENSTVENI (23 SLOVA).

DA LI SAM U PRAVU?




U pravu si da rec ima 23 slova, samo jos kad bi bila ljubazna da mi objasnis sta ista znaci? :O
"Ti sa svakim lijepo! I trazi da se dobra djela cine, a neznalica se kloni!" (El-'Araf, 199)

sans

Majstor

(31)

  • »sans« je muško

Postovi: 2.733

Datum registracije: 29.07.2002

Lokacija: Svemir/zemlja/Evropa/SCG/New Pazar

  • Poruku poslati

20

Četvrtak, 24. Juni 2004

Evo i jedne finske reči od 1873 slova

A kad smo već kod dužine reči, znate li da Bangkok , pored toga što je jedan od većih gradova po broju stanovnika ujedno i grad koji ima najduže ime od svih gradova u svetu?

Prvo mesto:
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiya­visanukamprasit -THAILAND (163)

Drugo mesto:
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoro­nuku­pokaiwhenua­kitanatahu NEW ZEALAND (85)




Treće mesto: Llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch -Nord Wales (58 )
Ako nemaš iskustva-prevariće te , a ako imaš - onda već jesu , onda već jesu , onda već jesu... ;)

i ... bode mi oči

... al lahko je tebi kad imas olovku sa gumicom

Social bookmarks